HEATR3 Recombinant monoclonal antibody

• 

  WB analysis of HEK-293 using 83643-4-RR

  WB result of HEATR3 antibody (83643-4-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-HEATR3 transfected HEK-293 cells.

• 

  WB analysis using 83643-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83643-4-RR (HEATR3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83643-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83643-4-RR against Human HEATR3 were performed. The affinity constant is 0.657 nM.

• Featured Product
• KD/KO Validated

HEATR3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83643-4-RR

Clone No.240561F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HEAT repeat-containing protein 3, HEAT repeat containing 3, 240561F7

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83643-4-RR targets HEATR3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26328

  Product name: Recombinant human HEATR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 501-680 aa of BC033077

  Sequence: SQPDFAKHVDFLEAISSALRALLQTMASKNISQCMTPDQLMTLCKAGIHSSNVGVRVNVVSILGITGSVLAKEDGTLETLKNIGCFLLEVTTKDPSLVVAGEALDALFDVFADGKEAERASIQIKLLSALKEFQPVFKMKIRKEGRGNYSTDQLCVLDNVKMNLRRFIAYQETVEKRLTS

• Full Name: HEAT repeat containing 3
• Calculated Molecular Weight: 680 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC033077
• Gene Symbol: HEATR3
• Gene ID (NCBI): 55027
• RRID: AB_3671253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q7Z4Q2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.