HEATR4 Polyclonal antibody

• 

  IHC staining of human testis using 23944-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 23944-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse testis using 23944-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23944-1-AP (HEATR4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 23944-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 23944-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 23944-1-AP (HEATR4 Antibody) at dilution of 1:50 (under 40x lens).

HEATR4 Polyclonal Antibody for IHC, ELISA

Cat No. 23944-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

HEAT repeat containing 4, HEATR4

---

Tested Applications

• Positive IHC detected in: human testis tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23944-1-AP targets HEATR4 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21056

  Product name: Recombinant human HEATR4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 630-979 aa of BC047590

  Sequence: NKEVRRAAAQALGQMSLGKEVHDIIRVKLGQGNSQERVEALYLIGELKLMTAKLLPSFLHCFSDDFTAVRRAACLAAGALQIRDKMVLECLLNLMQRDPYWKIKAFAIRALGQIGQVSPELTDLLLWAIHYEESPGVRLEACRSILALKLQGDRVRDTFLDVLLLENHDAVLKEMYQTMKILNLGNEGNQEMLQEIKNRIKTLSQKDLLTHKILKLEMVMGKVREEAKRVYLKPKGEQGPLTLQTLLQETFQDEMVLPRRPSEVCDTEAVIKPVKPRAPNPWLQSSVPGLTTRSKVRSSLVKDLRTSPEKRIAVGPFRSDYPALYLGKFSERTFFSPIMSSPSGKKGAHL

• Full Name: HEAT repeat containing 4
• Calculated Molecular Weight: 1026 aa, 117 kDa
• GenBank Accession Number: BC047590
• Gene Symbol: HEATR4
• Gene ID (NCBI): 399671
• RRID: AB_2879370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q86WZ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.