HEATR5B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HEATR5B Polyclonal antibody, PBS Only (32316-1-PBS)

• 

  WB analysis using 32316-1-AP (same clone as 32316-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32316-1-AP (HEATR5B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32316-1-PBS in a different storage buffer formulation.

HEATR5B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32316-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

HEAT repeat-containing protein 5B, KIAA1414, p200, p200a

---

Product Information

32316-1-PBS targets HEATR5B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36352

  Product name: Recombinant human HEATR5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 700-850 aa of BC150605

  Sequence: FTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPEEVR

• Full Name: HEAT repeat containing 5B
• Observed Molecular Weight: ~210 kDa
• GenBank Accession Number: BC150605
• Gene Symbol: HEATR5B
• Gene ID (NCBI): 54497
• RRID: AB_3742576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P2D3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HEATR5B (HEAT Repeat Containing 5B) is a protein containing HEAT repeat that binds directly to the dynein tail and dynactin and has an evolutionarily conserved function in promoting the motility of adaptor protein-1 (AP1)-associated endosomal membranes (PMID: 37872872).