HEATR6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HEATR6 Polyclonal antibody (22560-1-AP)

• 

  WB analysis using 22560-1-AP

  MCF-7 cells lysate was subjected to SDS PAGE followed by western blot with 22560-1-AP (HEATR6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 22560-1-AP

  IP result of anti-HEATR6 (IP:22560-1-AP, 4 ug; Detection:22560-1-AP 1:1000) with MCF-7 cells lysate 1520 ug.

HEATR6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22560-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

ABC1, HEAT repeat containing 6, HEAT repeat-containing protein 6

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IP detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22560-1-AP targets HEATR6 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18437

  Product name: Recombinant human HEATR6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 832-1181 aa of BC119813

  Sequence: AATSRALGVYVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQEEFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQALISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRSAAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ

• Full Name: HEAT repeat containing 6
• Calculated Molecular Weight: 1181 aa, 129 kDa
• Observed Molecular Weight: 129 kDa
• GenBank Accession Number: BC119813
• Gene Symbol: HEATR6
• Gene ID (NCBI): 63897
• RRID: AB_3742072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6AI08
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HEAT repeat-containing protein 6 (HEATR6) is amplified in certain breast cancer cell lines, such as MCF-7 and BT-474, suggesting its role in cancer progression. Additionally, HEATR6 is implicated in the regulation of gene expression, particularly in the context of long non-coding RNAs (lncRNAs) associated with breast cancer (PMID: 30953646).