HECTD3 Polyclonal antibody

• 

  WB analysis using 11487-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11487-1-AP (HECTD3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11487-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11487-1-AP (HECTD3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MDA-MB-453s using 11487-1-AP

  IP result of anti-HECTD3 (IP:11487-1-AP, 4ug; Detection:11487-1-AP 1:300) with MDA-MB-453s cells lysate 2800ug.

• 

  IHC staining of human stomach using 11487-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11487-1-AP (HECTD3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 11487-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11487-1-AP (HECTD3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

HECTD3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11487-1-AP

Publications(8)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

RP11 69J16.1, HECT-type E3 ubiquitin transferase HECTD3, HECT domain-containing protein 3, HECT domain containing 3, EC:2.3.2.26

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-453s cells
• Positive IP detected in: MDA-MB-453s cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IF: See 1 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

11487-1-AP targets HECTD3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1998

  Product name: Recombinant human HECTD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3-213 aa of BC019105

  Sequence: VMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE

• Full Name: HECT domain containing 3
• Calculated Molecular Weight: 861 aa, 97 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC019105
• Gene Symbol: HECTD3
• Gene ID (NCBI): 79654
• RRID: AB_2117517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T447
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HECTD3(HECT domain-containing protein 3) may be involved in the regulation of mitotic metaphase/anaphase transition. It can specifically ubiquitinate TRIOBP and target it for proteasomal degradation and it can also mediates the ubiquitination of STX8. HECTD3 is a new oncogenic E3 ligase in human prostate cancer.( Li Y, etc. 2008) HECTD3 may facilitate cell cycle progression via regulating ubiquitination and degradation of Tara(PMID:18194665). It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Commun; E3 ligase Nedd4l promotes antiviral innate immunity by catalyzing K29-linked cysteine ubiquitination of TRAF3.; Authors - Peng Gao
human	WB	Front Oncol; uc.77- Downregulation Promotes Colorectal Cancer Cell Proliferation by Inhibiting FBXW8-Mediated CDK4 Protein Degradation.; Authors - Zhijian Zheng
human	WB	Cell Death Discov; HECTD3 promotes gastric cancer progression by mediating the polyubiquitination of c-MYC.; Authors - Guanghui Zhang ; KD Validated
human,mouse	WB,IP	Br J Cancer; HECTD3 regulates the tumourigenesis of glioblastoma by polyubiquitinating PARP1 and activating EGFR signalling pathway; Authors - Guanghui Zhang ; KD Validated
human	CoIP	Cell Death Dis; Radiation induces IRAK1 expression to promote radioresistance by suppressing autophagic cell death via decreasing the ubiquitination of PRDX1 in glioma cells; Authors - Jing Li
mouse	IF	Cell Death Dis; HECTD3 inhibits NLRP3 inflammasome assembly and activation by blocking NLRP3-NEK7 interaction; Authors - Zhuo Cheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wei (Verified Customer) (01-23-2020)

Good, single band

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: C2C12