Tested Applications
| Positive WB detected in | MCF-7 cells, MDA-MB-453s cells |
| Positive IP detected in | MDA-MB-453s cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11487-1-AP targets HECTD3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1998 Product name: Recombinant human HECTD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-213 aa of BC019105 Sequence: VMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE Predict reactive species |
| Full Name | HECT domain containing 3 |
| Calculated Molecular Weight | 861 aa, 97 kDa |
| Observed Molecular Weight | 97 kDa |
| GenBank Accession Number | BC019105 |
| Gene Symbol | HECTD3 |
| Gene ID (NCBI) | 79654 |
| RRID | AB_2117517 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5T447 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HECTD3(HECT domain-containing protein 3) may be involved in the regulation of mitotic metaphase/anaphase transition. It can specifically ubiquitinate TRIOBP and target it for proteasomal degradation and it can also mediates the ubiquitination of STX8. HECTD3 is a new oncogenic E3 ligase in human prostate cancer.( Li Y, etc. 2008) HECTD3 may facilitate cell cycle progression via regulating ubiquitination and degradation of Tara(PMID:18194665). It has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HECTD3 antibody 11487-1-AP | Download protocol |
| IP protocol for HECTD3 antibody 11487-1-AP | Download protocol |
| WB protocol for HECTD3 antibody 11487-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HECTD3 polyclonal antibody (catalog #11487-1-AP) has 11 citations. These appear in journals including Drug Resistance Updates, Journal of Extracellular Vesicles, Nature Communications, Advanced Science, Cell Death & Disease, Cell Death Discovery, British Journal of Cancer, Cell Insight, Frontiers in Oncology, and Cell. The research spans cancer biology (hepatocellular, gastric, glioblastoma, colorectal, and lung cancers), ubiquitination/E3 ligase mechanisms, antiviral innate immunity, extracellular vesicle proteomics, and T cell exhaustion.
| Species | Application | Title |
|---|---|---|
Drug Resist Updat Exosome-derived lnc-FAM72D-3 promotes lenvatinib resistance by remodeling hepatocellular carcinoma cytoskeleton via MBNL1/FAK axis | ||
J Extracell Vesicles Identification of a Biomarker Panel in Extracellular Vesicles Derived From Non-Small Cell Lung Cancer (NSCLC) Through Proteomic Analysis and Machine Learning | ||
Nat Commun E3 ligase Nedd4l promotes antiviral innate immunity by catalyzing K29-linked cysteine ubiquitination of TRAF3. | ||
Adv Sci (Weinh) USP25 Elevates SHLD2-Mediated DNA Double-Strand Break Repair and Regulates Chemoresponse in Cancer | ||
Cell Death Dis Radiation induces IRAK1 expression to promote radioresistance by suppressing autophagic cell death via decreasing the ubiquitination of PRDX1 in glioma cells | ||
Cell Death Dis HECTD3 inhibits NLRP3 inflammasome assembly and activation by blocking NLRP3-NEK7 interaction |
Reviews
What customers say
Both reviewers rated the antibody 5 stars. One used it at 1:400 dilution across Western blot, immunohistochemistry, immunofluorescence, and immunoprecipitation, reporting excellent performance that significantly advanced their research. The other used it at 1:1000 dilution for Western blot on C2C12 cells, noting a clean single band. Overall, users find this antibody reliable, specific, and effective across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (01-08-2026) | Western blot, If , IHC - the anitbodies worked very well, entire reserch turned in a new direction, happy to have this!
|
Wei (Verified Customer) (01-23-2020) | Good, single band
|
