HECW1 Polyclonal antibody

• 

  IHC staining of human urothelial carcinoma using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HECW1 Polyclonal Antibody for IHC, ELISA

Cat No. 24695-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HECW1, hNEDL1, KIAA0322, NEDL1

---

Tested Applications

• Positive IHC detected in: human urothelial carcinoma tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

24695-1-AP targets HECW1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20264

  Product name: Recombinant human HECW1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC151227

  Sequence: MLLHLCSVKNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDGVTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDD

• Full Name: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
• Calculated Molecular Weight: 1606 aa, 180 kDa
• GenBank Accession Number: BC151227
• Gene Symbol: HECW1
• Gene ID (NCBI): 23072
• RRID: AB_2918085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q76N89
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	World J Surg Oncol; High expression of HECW1 is associated with the poor prognosis and cancer progression of gastric cancer; Authors - Zhihui Yang ; KD Validated