HECW1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HECW1 Polyclonal antibody (24695-1-AP)

HECW1 Polyclonal Antibody for IHC, ELISA

Cat No. 24695-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HECW1, hNEDL1, KIAA0322, NEDL1

• 

  IHC staining of human urothelial carcinoma using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human urothelial carcinoma using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 24695-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24695-1-AP (HECW1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HECW1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human urothelial carcinoma tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24695-1-AP targets HECW1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20264

  Product name: Recombinant human HECW1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC151227

  Sequence: MLLHLCSVKNLYQNRFLGLAAMASPSRNSQSRRRCKEPLRYSYNPDQFHNMDLRGGPHDGVTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAAPIFKSIGADETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSIFPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKLSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDD

• Full Name: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
• Calculated Molecular Weight: 1606 aa, 180 kDa
• GenBank Accession Number: BC151227
• Gene Symbol: HECW1
• Gene ID (NCBI): 23072
• RRID: AB_2918085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q76N89
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HECW1 Polyclonal antibody (Cat# 24695-1-AP) has 1 total citation. It appears in World Journal of Surgical Oncology (2025), in a study investigating HECW1 expression and its association with poor prognosis and cancer progression in gastric cancer. The cited application is Western blot in human samples, with RNAi validation. The research field is gastric cancer oncology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	World J Surg Oncol; High expression of HECW1 is associated with the poor prognosis and cancer progression of gastric cancer; Authors - Zhihui Yang ; KD Validated