HELZ Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HELZ Polyclonal antibody (26635-1-AP)

HELZ Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26635-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA0054, HUMORF5, DRHC, DHRC

• 

  WB analysis of HeLa using 26635-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26635-1-AP (HELZ Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 26635-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26635-1-AP (HELZ Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 26635-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26635-1-AP (HELZ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 26635-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26635-1-AP (HELZ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26635-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using HELZ antibody (26635-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HELZ in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26635-1-AP targets HELZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24326

  Product name: Recombinant human HELZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC130582

  Sequence: MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYMQADEDCRHVLGEGLAKGEDAFRAVLCCM

• Full Name: helicase with zinc finger
• Calculated Molecular Weight: 1942 aa, 219 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC130582
• Gene Symbol: HELZ
• Gene ID (NCBI): 9931
• RRID: AB_2880584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HELZ Polyclonal antibody (Cat# 26635-1-AP) has 1 total citation. It was cited in Nature Communications (IF 18.1) in a 2026 study investigating HELZ as an RNA-DNA helicase that resolves R loops to facilitate homologous recombination repair. The associated research field is DNA repair and homologous recombination.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Commun; HELZ is a RNA-DNA helicase that resolves R loops to facilitate homologous recombination repair.; Authors - Ramona Haji-Seyed-Javadi