HEN1,NHLH1 Polyclonal antibody

• 

HEN1,NHLH1 Polyclonal Antibody for ELISA

Cat No. 12736-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

bHLHa35, Helix loop helix protein 1, HEN 1, HEN1, nescient helix loop helix 1, NHLH1, NSCL, NSCL 1, NSCL1

---

Product Information

12736-1-AP targets HEN1,NHLH1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3459

  Product name: Recombinant human HEN1,NHLH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC013789

  Sequence: MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKI

• Full Name: nescient helix loop helix 1
• Calculated Molecular Weight: 133 aa, 15 kDa
• GenBank Accession Number: BC013789
• Gene Symbol: HEN1
• Gene ID (NCBI): 4807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02575
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.