Tested Applications
| Positive IF-P detected in | human breast cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-60311 targets HER2/ErbB2 in IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16463 Product name: Recombinant human ERBB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-372 aa of BC156755 Sequence: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG Predict reactive species |
| Full Name | v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) |
| Calculated Molecular Weight | 1255 aa, 138 kDa |
| GenBank Accession Number | BC156755 |
| Gene Symbol | HER2/ErbB2 |
| Gene ID (NCBI) | 2064 |
| RRID | AB_2883460 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04626 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HER2, also known as ErbB2 and Neu, is a 185-kDa transmembrane glycoprotein that is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. It has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Amplification and/or overexpression of HER2 have been reported in numerous cancers, including breast and ovarian tumors. HER2 is a therapeutic target for the treatment of breast cancer and other carcinomas.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 HER2/ErbB2 antibody CL594-60311 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

