HER2/ErbB2 Monoclonal antibody

This HER2/ErbB2 antibody is a mouse monoclonal antibody that targets HER2/ErbB2 in IHC, IF-P, ELISA and is suitable for human samples.
Cat No. 60311-1-Ig
Clone No.1B12A7

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF-P, ELISA

ERBB2, 1B12A7, CD340, HER 2, HER 2/neu

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive FC detected inSK-BR-3 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:800-1:3200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60311-1-Ig targets HER2/ErbB2 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16463

Product name: Recombinant human ERBB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-372 aa of BC156755

Sequence: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG

Predict reactive species
Full Name v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Calculated Molecular Weight 1255 aa, 138 kDa
GenBank Accession NumberBC156755
Gene Symbol HER2/ErbB2
Gene ID (NCBI) 2064
RRIDAB_2881423
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04626
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HER2, ErbB2, and Neu is a 185-kDa transmembrane glycoprotein member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. It has no ligand-binding domain and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Amplification and/or overexpression of HER2 have been reported in numerous cancers, including breast and ovarian tumors. HER2 is a therapeutic target for the treatment of breast cancer and other carcinomas.

Protocols

Product Specific Protocols
IF protocol for HER2/ErbB2 antibody 60311-1-IgDownload protocol
IHC protocol for HER2/ErbB2 antibody 60311-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Cancer

InvivoPen: A novel plasma source for in vivo cancer treatment.

Authors - Xin Zhou
humanIHC

Mol Med Rep

HPK1 positive expression associated with longer overall survival in patients with estrogen receptor-positive invasive ductal carcinoma‑not otherwise specified.

Authors - Jiaojiao Wang
humanIHC

Oncol Lett

Circulating HER-2 mRNA in the peripheral blood as a potential diagnostic and prognostic biomarker in females with breast cancer.

Authors - Yanlin Wu
humanIHC

Int J Cancer

Establishment of patient-derived organoids for guiding personalized therapies in breast cancer patients

Authors - Huizi Wu
humanIHC

Front Med (Lausanne)

Synchronous neuroendocrine tumor and signet ring cell carcinoma in the stomach: a case report and review of literature

Authors - Jian Han
humanIF

Adv Mater

Targeted SERS Imaging and Intraoperative Real-Time Elimination of Microscopic Tumors for Improved Breast-Conserving Surgery

Authors - Yu Wen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Felletár (Verified Customer) (06-25-2025)

Immunostaining was performed using an automated staining, covering, and scanning system. FFPE slides were incubated for 30 minutes. HRP conjugated one step development system, scanning under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:5000 ( 30min )
  • Cell Tissue Type: Human breast carces tissue
HER2/ErbB2 Antibody Immunohistochemistry validation (1:5000 ( 30min ) dilution) in Human breast carces tissue (Cat no:60311-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...