CoraLite® Plus 488-conjugated HER2/ErbB2 Monoclonal antibody

HER2/ErbB2 Monoclonal Antibody for IF-P
Cat No. CL488-60311
Clone No.1B12A7

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF-P

CD340, ERBB2, HER 2, HER 2/neu, HER2, HER2/ErbB2, MLN 19, MLN19, NEU, NGL, p185, p185erbB2, Proto oncogene c ErbB 2, Proto oncogene Neu, TKR1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman breast cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60311 targets HER2/ErbB2 in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16463

Product name: Recombinant human ERBB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-372 aa of BC156755

Sequence: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG

Predict reactive species
Full Name v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Calculated Molecular Weight 1255 aa, 138 kDa
GenBank Accession NumberBC156755
Gene Symbol HER2/ErbB2
Gene ID (NCBI) 2064
RRIDAB_2883140
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04626
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HER2, also known as ErbB2 and Neu, is a 185-kDa transmembrane glycoprotein that is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. It has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Amplification and/or overexpression of HER2 have been reported in numerous cancers, including breast and ovarian tumors. HER2 is a therapeutic target for the treatment of breast cancer and other carcinomas.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HER2/ErbB2 antibody CL488-60311Download protocol
FC protocol for CL Plus 488 HER2/ErbB2 antibody CL488-60311Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...