HERC4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84952-5-RR (same clone as 84952-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84952-5-RR (HERC4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84952-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 84952-5-RR (same clone as 84952-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84952-5-RR (HERC4 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84952-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84952-5-RR (same clone as 84952-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using HERC4 antibody (84952-5-RR, Clone: 242599B7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84952-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84952-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84952-5-RR against Human HERC4 were performed. The affinity constant is 0.51 nM.

HERC4 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84952-5-PBS

Clone No.242599B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242599B7, EC:2.3.2.26, HECT domain and RCC1-like domain-containing protein 4, hect domain and RLD 4, HECT-type E3 ubiquitin transferase HERC4

---

Product Information

84952-5-PBS targets HERC4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4566

  Product name: Recombinant human HERC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 723-1049 aa of BC039600

  Sequence: NIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI

• Full Name: hect domain and RLD 4
• Calculated Molecular Weight: 1049 aa, 118 kDa
• Observed Molecular Weight: 107 kDa
• GenBank Accession Number: BC039600
• Gene Symbol: HERC4
• Gene ID (NCBI): 26091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5GLZ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HERC4, also known as HECT and RLD domain containing E3 ubiquitin protein ligase 4, is a protein encoded by the HERC4 gene in humans. HERC4 is a novel member of HERC family. The mRNA of HERC4 has been found in all examined tissues, with its levels being significantly higher in the brain and testis than in the placenta and heart. (PMID: 28430527)