HES5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HES5 Polyclonal antibody (22666-1-AP)

HES5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22666-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

bHLHb38, Hairy and enhancer of split 5, HES5, Transcription factor HES 5

• 

  WB analysis of rat brain using 22666-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22666-1-AP (HES5 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22666-1-AP (HES5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22666-1-AP (HES5 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22666-1-AP (HES5 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HES5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22666-1-AP targets HES5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, mink
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18270

  Product name: Recombinant human HES5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC087840

  Sequence: MRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW

• Full Name: hairy and enhancer of split 5 (Drosophila)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC087840
• Gene Symbol: HES5
• Gene ID (NCBI): 388585
• RRID: AB_2879147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TA89
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HES5, also known as bHLHb38, has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). HES5 is expressed in fetal heart and brain tumors. HES5 as a transcriptional repressor of genes that require a bHLH protein for their transcription and plays an important role as neurogenesis negative regulator. HES5 is detected with molecular weight of 41 kDa according to the publication (PMID: 24286475).

Publications

What published studies show

The HES5 Polyclonal antibody (Cat# 22666-1-AP) has 18 citations spanning journals including Cell Death & Disease, Developmental Cell, Cell Reports, Frontiers in Immunology, Life Sciences, Drug Design, Development and Therapy, Frontiers in Pharmacology, Molecular Medicine Reports, Neurochemistry Research, Journal of Cellular Physiology, American Journal of Cancer Research, Current Therapeutic Research, PLoS ONE, and International Journal of Neuroscience. Research fields cover Notch signaling, cancer, neurology, immunology, stem cell biology, and bone biology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; hPER3 promotes adipogenesis via hHSP90AA1-mediated inhibition of Notch1 pathway.; Authors - Xinxing Wan
human	WB	Cell Death Dis; PRMT1-catalyzed NUSAP1 methylation enhances Notch2 signaling and 5-FU resistance in gastric cancer; Authors - Suting Jiang
mouse	WB	Dev Cell; Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination; Authors - Li Li
mouse	WB	Dev Cell; Regulation of reverse electron transfer at mitochondrial complex I by unconventional Notch action in cancer stem cells.; Authors - Rani Ojha
human	WB	Cell Rep; Stub1 maintains proteostasis of master transcription factors in embryonic stem cells.; Authors - Md Mahfuz Al Mamun
mouse	WB	Front Immunol; Unveiling the neutrophil-Notch2-ISC axis: asiatic acid's therapeutic strategy in infectious colitis.; Authors - Wenshu Zou