HES5 Polyclonal antibody

• 

  WB analysis using 22666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22666-1-AP (HES5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 22666-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22666-1-AP (HES5 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  IHC staining of mouse brain using 22666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22666-1-AP (HES5 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse brain using 22666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22666-1-AP (HES5 Antibody) at dilution of 1:50 (under 10x lens).

HES5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22666-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

bHLHb38, Hairy and enhancer of split 5, HES5, Transcription factor HES 5

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 14 publications below
• IHC: See 1 publications below

Product Information

22666-1-AP targets HES5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, mink
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18270

  Product name: Recombinant human HES5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC087840

  Sequence: MRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW

• Full Name: hairy and enhancer of split 5 (Drosophila)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC087840
• Gene Symbol: HES5
• Gene ID (NCBI): 388585
• RRID: AB_2879147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TA89
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HES5, also known as bHLHb38, has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). HES5 is expressed in fetal heart and brain tumors. HES5 as a transcriptional repressor of genes that require a bHLH protein for their transcription and plays an important role as neurogenesis negative regulator. HES5 is detected with molecular weight of 41 kDa according to the publication (PMID: 24286475).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Dev Cell; Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination; Authors - Li Li
mouse	WB	Dev Cell; Regulation of reverse electron transfer at mitochondrial complex I by unconventional Notch action in cancer stem cells.; Authors - Rani Ojha
human	WB	Cell Rep; Stub1 maintains proteostasis of master transcription factors in embryonic stem cells.; Authors - Md Mahfuz Al Mamun
human,mouse	WB,IHC	Am J Cancer Res; PRDM16 from hepatic stellate cells-derived extracellular vesicles promotes hepatocellular carcinoma progression; Authors - Chen Sun
rat	WB	Front Pharmacol; Danzhi Xiaoyao Powder Promotes Neuronal Regeneration by Downregulating Notch Signaling Pathway in the Treatment of Generalized Anxiety Disorder.; Authors - Chao Liu
mink	WB	Life Sci; Pantothenic acid promotes dermal papilla cell proliferation in hair follicles of American minks via inhibitor of DNA Binding 3/Notch signaling pathway.; Authors - Zhuo Wang