HEXIM2 Polyclonal antibody

• 

  WB analysis of C6 using 16598-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 16598-1-AP (HEXIM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16598-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16598-1-AP (HEXIM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 16598-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 16598-1-AP (HEXIM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16598-1-AP (HEXIM2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16598-1-AP (HEXIM2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 16598-1-AP (HEXIM2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 16598-1-AP (HEXIM2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human urothelial carcinoma using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 16598-1-AP (HEXIM2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 16598-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 16598-1-AP (HEXIM2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 16598-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using HEXIM2 antibody (16598-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

HEXIM2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16598-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein HEXIM2, L3, Hexamethylene bis-acetamide-inducible protein 2

---

Tested Applications

• Positive WB detected in: C6 cells, COLO 320 cells, HEK-293 cells
• Positive IHC detected in: human lung cancer tissue, human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16598-1-AP targets HEXIM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9754

  Product name: Recombinant human HEXIM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-286 aa of BC025970

  Sequence: MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT

• Full Name: hexamthylene bis-acetamide inducible 2
• Calculated Molecular Weight: 286 aa, 32 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC025970
• Gene Symbol: HEXIM2
• Gene ID (NCBI): 124790
• RRID: AB_2878286
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.