HEY1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• HEY1 Recombinant monoclonal antibody (87307-1-RR)

• 

  WB analysis using 87307-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87307-1-RR (HEY1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HEY1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87307-1-RR

Clone No.252516D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bHLHb31, CHF 2, CHF2, CHF-2, HERP2

---

Tested Applications

• Positive WB detected in: A549 cells, HCT 116 cells, 143B cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87307-1-RR targets HEY1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14094

  Product name: Recombinant human HEY1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 155-295 aa of BC001873

  Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR

• Full Name: hairy/enhancer-of-split related with YRPW motif 1
• Calculated Molecular Weight: 304 aa, 33 kDa
• Observed Molecular Weight: 32-34 kDa
• GenBank Accession Number: BC001873
• Gene Symbol: HEY1
• Gene ID (NCBI): 23462
• RRID: AB_3745459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5J3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hairy/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating.