HFM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HFM1 Polyclonal antibody (33841-1-AP)

• 

  WB analysis using 33841-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33841-1-AP (HFM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

HFM1 Polyclonal Antibody for WB, ELISA

Cat No. 33841-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

SEC3D1

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells, MDA-MB-231 cells, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33841-1-AP targets HFM1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40875

  Product name: Recombinant human HFM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 333-518 aa of BC130525

  Sequence: LPKYELKVEQITRYSDTTAEILVTVILRNFEQLQTKRTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSEFVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCKSKHTCGHDCCKIGVAQKSEIKE

• Full Name: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC130525
• Gene Symbol: HFM1
• Gene ID (NCBI): 164045
• RRID: AB_3743089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A2PYH4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HFM1 (helicase for meiosis 1), also known as MER3, POF9, Si-11, SEC63D1, and Si-11-6, is a candidate gene of POI. HFM1 was reported to be mainly expressed in germline cells, which is required for crossover formation and complete synapsis of homologous chromosomes in spermiogenesis HFM1, expressed specifically in germline tissues, is a typical ATP-dependent DNA helicase mediating meiosis (PMID: 39725823, 37020390).