HGD Polyclonal antibody

• 

  WB analysis using 16465-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16465-1-AP (HGD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16465-1-AP

  Rat liver tissues were subjected to SDS PAGE followed by western blot with 16465-1-AP (HGD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16465-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16465-1-AP (HGD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 16465-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16465-1-AP (HGD antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 16465-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16465-1-AP (HGD antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HGD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16465-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

AKU, EC:1.13.11.5, HGO, Homogentisate 1,2 dioxygenase, Homogentisate 1,2-dioxygenase

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, rat liver tissue, mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16465-1-AP targets HGD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9544

  Product name: Recombinant human HGD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC020792

  Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL

• Full Name: homogentisate 1,2-dioxygenase (homogentisate oxidase)
• Calculated Molecular Weight: 37 kDa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC020792
• Gene Symbol: HGD
• Gene ID (NCBI): 3081
• RRID: AB_2248397
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93099
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Homogentisate1,2-dioxygenase (HGD), also named as HGO, is a mononuclear Fe(II)-dependent oxygenase that catalyzes the third step in the pathway for the catabolism of tyrosine, the conversion of homogentisate (HG) to maleylacetoacetate (MAA) and it can exsit as a dimer or trimer(PMID:14678794). HGD consists of a single type of subunit with no intermolecular disulfide bridges and requires Fe2+ as a cofactor(PMID: 7705358). Defects in HGD are the cause of alkaptonuria (AKU)(PMID:10594001).