HGF Recombinant monoclonal antibody, PBS Only

• 

HGF Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83453-1-PBS

Clone No.240383A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

HGF Alpha, Hepatocyte growth factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain, Hepatopoietin-A

---

Product Information

83453-1-PBS targets HGF in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25478

  Product name: Recombinant human HGF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-157 aa of BC130286

  Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

• Full Name: hepatocyte growth factor (hepapoietin A; scatter factor)
• GenBank Accession Number: BC130286
• Gene Symbol: HGF
• Gene ID (NCBI): 3082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.