HHIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HHIP Polyclonal antibody, PBS Only (29466-1-PBS)

• 

  WB analysis using 29466-1-AP (same clone as 29466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29466-1-AP (HHIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 29466-1-AP (same clone as 29466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29466-1-AP (HHIP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29466-1-AP (same clone as 29466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29466-1-AP (HHIP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29466-1-AP (same clone as 29466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29466-1-AP (HHIP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29466-1-AP (same clone as 29466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29466-1-AP (HHIP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 29466-1-AP (same clone as 29466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29466-1-AP (HHIP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29466-1-AP (same clone as 29466-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using HHIP antibody (29466-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29466-1-PBS in a different storage buffer formulation.

HHIP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29466-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29466-1-PBS targets HHIP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30869

  Product name: Recombinant human HHIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-277 aa of BC025311

  Sequence: FFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIK

• Full Name: hedgehog interacting protein
• Calculated Molecular Weight: 700 aa, 79 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC025311
• Gene Symbol: HHIP
• Gene ID (NCBI): 64399
• RRID: AB_3086136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QV1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The hedgehog (HH) proteins are evolutionarily conserved protein, which are important morphogens for a wide range of developmental processes, including anteroposterior patterns of limbs and regulation of left-right asymmetry in embryonic development. Multiple cell-surface receptors are responsible for transducing and/or regulating HH signals. HHIP is a highly conserved, vertebrate-specific inhibitor of HH signaling. It interacts with all three HH family members, SHH, IHH and DHH.