HIC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HIC1 Polyclonal antibody (24949-1-AP)

HIC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24949-1-AP Copied!

Publications (5)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

Zinc finger and BTB domain-containing protein 29, ZBTB29, hypermethylated in cancer 1, Hic-1, hic 1

• 

  WB analysis of Jurkat using 24949-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24949-1-AP (HIC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 24949-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24949-1-AP (HIC1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 24949-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 24949-1-AP (HIC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 24949-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 24949-1-AP (HIC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HIC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, NIH/3T3 cells
• Positive IHC detected in: rat lung tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24949-1-AP targets HIC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21849

  Product name: Recombinant human HIC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 89-408 aa of BC157027

  Sequence: DGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYG

• Full Name: hypermethylated in cancer 1
• Calculated Molecular Weight: 714 aa, 75 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC157027
• Gene Symbol: HIC1
• Gene ID (NCBI): 3090
• RRID: AB_2879816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14526
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HIC1 Polyclonal antibody (Cat# 24949-1-AP) has 5 citations published in Advanced Science, Frontiers in Immunology, Cancer Cell International, Frontiers in Cell and Developmental Biology, and Digestive Diseases and Sciences. The research fields span gastric cancer pyroptosis, ferroptosis-related immunotherapy prediction, bladder cancer progression, ovarian cancer diagnosis, and acute pancreatitis.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Adv Sci (Weinh); HIC1 suppresses Tumor Progression and Enhances CD8+ T Cells Infiltration Through Promoting GSDMD-induced Pyroptosis in Gastric Cancer; Authors - Mengjie Kang
human	WB,IHC	Cancer Cell Int; ZBTB7A, a miR-144-3p targeted gene, accelerates bladder cancer progression via downregulating HIC1 expression.; Authors - Junqiang Liu
human	IHC	Front Immunol; Ferroptosis-related gene HIC1 in the prediction of the prognosis and immunotherapeutic efficacy with immunological activity; Authors - Yanlin Wu
human	WB	Front Cell Dev Biol; Integrated Analysis of Ferroptosis-Related Biomarker Signatures to Improve the Diagnosis and Prognosis Prediction of Ovarian Cancer.; Authors - Huan Wang
human	WB	Dig Dis Sci; Mechanistic Investigation of FBXW11-Mediated Ubiquitination and Degradation of HIC1 in Regulating IRF1 Transcription and Accelerating Acute Pancreatitis Progression.; Authors - Hai Jiang ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer used this antibody at a 1/300 dilution for immunofluorescence staining of mouse embryo fibroblasts and reported excellent results, giving it a perfect 5-star rating. The user described the staining performance as "amazing," indicating strong satisfaction with the product's specificity and signal quality in this application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Shazia (Verified Customer) (08-25-2025)

I used it to stain fibroblasts and it worked amazingly.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/300
• Cell Tissue Type: Mice Embryo