HIF1AN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HIF1AN Polyclonal antibody (10646-1-AP)

• Featured Product
• KD/KO Validated

HIF1AN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10646-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Factor inhibiting HIF 1, FIH 1, FIH1, HIF1AN

• 

  WB analysis of HEK-293 using 10646-1-AP

  WB result of HIF1AN antibody (10646-1-AP; 1:500; incubated at room temperature for 1.5 hours) with sh-Control and sh-HIF1AN transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10646-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10646-1-AP (HIF1AN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10646-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10646-1-AP (HIF1AN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10646-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10646-1-AP (HIF1AN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HIF1AN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10646-1-AP targets HIF1AN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0997

  Product name: Recombinant human HIF1AN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC007719

  Sequence: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

• Full Name: hypoxia inducible factor 1, alpha subunit inhibitor
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC007719
• Gene Symbol: HIF1AN
• Gene ID (NCBI): 55662
• RRID: AB_2232963
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HIF1AN (Hypoxia-inducible factor 1-alpha inhibitor) is also named FIH1. It is identified as a molecular oxygen-dependent dioxygenase that blunts the transcriptional activity of HIF and has also been implicated in HIF-dependent and -independent hypoxia responses(PMID:20720525). Structural studies indicate that an FIH-1 homodimer forms in solution and is essential for FIH-1 activity(PMID:16154531).

Publications

What published studies show

The HIF1AN Polyclonal antibody (Cat# 10646-1-AP) has 6 total citations published in Bioact Mater, Advanced Science, Cell Death & Disease, Analytical Chemistry, Heliyon, and American Journal of Cancer Research. Research fields span diabetic wound healing via RNAi therapy, AMPK-dependent thermogenic metabolism, cardiac remodeling, proteomic sample preparation, ferroptosis in spinal cord injury, and hepatocellular carcinoma oncogenesis. All citations used the antibody for Western blot applications across human, mouse, and rat species.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Bioact Mater; Development of a novel RNAi therapy: Engineered miR-31 exosomes promoted the healing of diabetic wounds.; Authors - Jinghuan Huang
mouse	WB	Adv Sci (Weinh); Exclusive Breastfeeding Drives AMPK-Dependent Thermogenic Memory in BAT and Promotes Long-Term Metabolic Benefits in Offspring.; Authors - Ningxi Wu
mouse,rat	WB	Cell Death Dis; Asb10 accelerates pathological cardiac remodeling by stabilizing HSP70; Authors - Ke Lin
human	WB	Anal Chem; A Miniaturized, Automated Proteomic Sample Preparation Platform for High-Throughput Target Deconvolution of Natural Products.; Authors - Qiong Wu
rat	WB	Heliyon; LncRNA OIP5-AS1 regulates ferroptosis and mitochondrial dysfunction-mediated apoptosis in spinal cord injury by targeting the miR-128-3p/Nrf2 axis; Authors - Zhensong Jiang
human	WB	Am J Cancer Res; Experimental and clinical evidence suggests that GRPEL2 plays an oncogenic role in HCC development.; Authors - Ming-Chun Lai