Histone H1.5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Histone H1.5 Polyclonal antibody, PBS Only (18093-1-PBS)

• 

  WB analysis using 18093-1-AP (same clone as 18093-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18093-1-AP (Histone H1.5 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 18093-1-AP (same clone as 18093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 18093-1-AP (Histone H1.5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18093-1-AP (same clone as 18093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18093-1-AP (Histone H1.5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 18093-1-AP (same clone as 18093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18093-1-AP (Histone H1.5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 18093-1-AP (same clone as 18093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 18093-1-AP (Histone H1.5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 18093-1-AP (same clone as 18093-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18093-1-AP (Histone H1.5 antibody) at dilution of 1:6000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 18093-1-AP (same clone as 18093-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using Histone H1.5 antibody (18093-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18093-1-PBS in a different storage buffer formulation.

Histone H1.5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18093-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HIST1H1B, histone cluster 1, H1b, Histone, H1F5, H1-5

---

Product Information

18093-1-PBS targets Histone H1.5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12818

  Product name: Recombinant human HIST1H1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC101581

  Sequence: MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK

• Full Name: histone cluster 1, H1b
• Calculated Molecular Weight: 226 aa, 23 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC101581
• Gene Symbol: HIST1H1B
• Gene ID (NCBI): 3009
• RRID: AB_3085553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16401
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Histone H1.5, also known as Histone Cluster 1 H1 Family Member B (HIST1H1B), is a member of the Histone H1/H5 protein family. Histone H1.5 gene has been found to be frequently mutated in colorectal cancer and follicular lymphomas. HIST1H1B overexpression contributes to tumor aggressiveness. Histone H1.5 expression is upregulated in breast cancer and predicts poor prognosis(PMID: 34746019).