HIST1H1T Polyclonal antibody

• 

  WB analysis using 18188-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18188-1-AP (HIST1H1T antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 18188-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18188-1-AP (HIST1H1T antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 18188-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18188-1-AP (HIST1H1T antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 18188-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HIST1H1T antibody (18188-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

HIST1H1T Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18188-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Histone H1t, Histone H1, Histone, H1t, H1FT

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

18188-1-AP targets HIST1H1T in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12908

  Product name: Recombinant human HIST1H1T protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC069517

  Sequence: MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSK

• Full Name: histone cluster 1, H1t
• Calculated Molecular Weight: 206 aa, 22 kDa
• Observed Molecular Weight: 22-30 kDa
• GenBank Accession Number: BC069517
• Gene Symbol: HIST1H1T
• Gene ID (NCBI): 3010
• RRID: AB_2878515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22492
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Testis-specific histone variants facilitate histone to protamine exchange during maturation of spermatozoa. Three testis-specific histone variants are regulated in male germ cells including H1T, H1T2 and HILS1 (encoded by H1ST1H1T, H1T2 and HILS1 respectively).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Cycle; Function of RAD6B and RNF8 in spermatogenesis.; Authors - Yingli Guo
mouse	IF	Biol Reprod; UHRF1 is indispensable for meiotic sex chromosome inactivation and interacts with the DNA damage response pathway in mice.; Authors - Mengneng Xiong
mouse	IF	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ihsan (Verified Customer) (03-03-2023)

This antibody did not work in our hands to detect H1t or any other specific nuclear structure on mouse spermatocyte nuclear spreads, contrary to a previously published paper that used it and was able to detect H1t on same type of samples.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Mouse spermatocyte nuclear spreads

HIST1H1T Antibody Immunofluorescence validation (1:100 dilution) in Mouse spermatocyte nuclear spreads (Cat no:18188-1-AP)