HIST1H2BN Polyclonal antibody

• 

HIST1H2BN Polyclonal Antibody for ELISA

Cat No. 16198-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

H2B/d, H2BFD, HIST1H2BN, HIST1H3I, histone cluster 1, H2bn, Histone H2B type 1 N, Histone H2B.d

---

Product Information

16198-1-AP targets HIST1H2BN in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9071

  Product name: Recombinant human HIST1H2BN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC009783

  Sequence: MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 1, H2bn
• Calculated Molecular Weight: 126 aa, 14 kDa
• GenBank Accession Number: BC009783
• Gene Symbol: HIST1H2BN
• Gene ID (NCBI): 8341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99877
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.