HIST1H4F Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HIST1H4F Polyclonal antibody, PBS Only (18341-1-PBS)

• 

  WB analysis of human spleen using 18341-1-AP (same clone as 18341-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 18341-1-AP (HIST1H4F antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18341-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 18341-1-AP (same clone as 18341-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 18341-1-AP (HIST1H4F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18341-1-PBS in a different storage buffer formulation.

HIST1H4F Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18341-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18341-1-PBS targets HIST1H4F in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13113

  Product name: Recombinant human HIST1H4F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-103 aa of BC093763

  Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

• Full Name: histone cluster 1, H4f
• Calculated Molecular Weight: 103 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC093763
• Gene Symbol: HIST1H4F
• Gene ID (NCBI): 8361
• RRID: AB_2878533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62805
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.