HIST2H2AA4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HIST2H2AA4 Polyclonal antibody (15302-1-AP)

HIST2H2AA4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15302-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

H2A/R, H2AFO, HIST2H2AA, HIST2H2AA3, HIST2H2AA4, histone, histone cluster 2, H2aa4, Histone H2A type 2 A, Histone H2A.2, Histone H2A/o

• 

  WB analysis of L02 using 15302-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15302-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 15302-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15302-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15302-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 15302-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15302-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15302-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15302-1-AP (HIST2H2AA4 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HIST2H2AA4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, Jurkat cells, K-562 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15302-1-AP targets HIST2H2AA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7560

  Product name: Recombinant human HIST2H2AA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC001629

  Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

• Full Name: histone cluster 2, H2aa4
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC001629
• Gene Symbol: HIST2H2AA4
• Gene ID (NCBI): 723790
• RRID: AB_2878124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6FI13
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HIST2H2AA4 Polyclonal antibody (Cat# 15302-1-AP) has 1 total citation. It was published in Cell Physiol Biochem (2016), in a study examining the effect of Type I Diabetes on the proteome of mouse oocytes. The citation is associated with the research fields of diabetes, proteomics, and reproductive biology, and the antibody was applied in Western Blot (WB) using mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Physiol Biochem; Effect of Type I Diabetes on the Proteome of Mouse Oocytes.; Authors - Guangjian Jiang