Histone H2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Histone H2B Polyclonal antibody (15857-1-AP)

Histone H2B Polyclonal Antibody for WB, IHC, IF, IP, ELISA

Cat No. 15857-1-AP

Publications(33)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

H2B, HIST2H2BE, GL105, H2B.1, H2B/q

• 

  WB analysis using 15857-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15857-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 15857-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 15857-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 15857-1-AP (Histone H2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 15857-1-AP

  IP result of anti-Histone H2B (IP:15857-1-AP, 4ug; Detection:15857-1-AP 1:500) with HEK-293 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15857-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15857-1-AP (Histone H2B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15857-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15857-1-AP (Histone H2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15857-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15857-1-AP (Histone H2B Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15857-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15857-1-AP (Histone H2B Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining using 15857-1-AP

  Mouse tumour sections were labelled with H2B (15857-1-AP, red), Dendra2 (green), and DAPI. The image was credited by Dr. Hae Lin Jang from Harvard Medical School.

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse pancreas tissue, rat kidney tissue, U2OS cells, mouse kidney tissue, Jurkat cells, NIH/3T3 cells, C2C12 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human prostate cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF detected in: N/A

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF): IF : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15857-1-AP targets Histone H2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7811

  Product name: Recombinant human Histone H2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-126 aa of BC005827

  Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

• Full Name: histone cluster 2, H2be
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC005827
• Gene Symbol: Histone H2B
• Gene ID (NCBI): 8349
• RRID: AB_10664929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16778
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nat Nanotechnol; Intercellular nanotubes mediate mitochondrial trafficking between cancer and immune cells.; Authors - Tanmoy Saha
human	IF	Nat Biomed Eng; Aberrant chromatin reorganization in cells from diseased fibrous connective tissue in response to altered chemomechanical cues; Authors - Su-Jin Heo
human	WB	Oncogene; HIPK2 and extrachromosomal histone H2B are separately recruited by Aurora-B for cytokinesis.; Authors - Laura Monteonofrio
human	WB	Elife; Non-canonical H3K79me2-dependent pathways promote the survival of MLL-rearranged leukemia.; Authors - William F Richter
human	WB	Mol Cell Proteomics; Chemoproteomics Reveals Chemical Diversity and Dynamics of 4-Oxo-2-nonenal Modifications in Cells.; Authors - Rui Sun
human	WB	Cell Discov; USP7 negatively controls global DNA methylation by attenuating ubiquitinated histone-dependent DNMT1 recruitment.; Authors - Jialun Li

Reviews

4.0 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Roy (Verified Customer) (11-19-2025)

Worked well to detect H2B in Jurkat cells at the right size.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Jurkat

Gunjita (Verified Customer) (01-06-2020)

N/A

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Hek293

Aurelie (Verified Customer) (11-19-2018)

strong signal around 20-25kda in mouse cortex (25µg) at 1:1000, (1:2000 should be ok as well)

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: mouse cortex