Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, mouse pancreas tissue, rat kidney tissue, U2OS cells, mouse kidney tissue, Jurkat cells, NIH/3T3 cells, C2C12 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human prostate cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF detected in | N/A |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF) | IF : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15857-1-AP targets Histone H2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7811 Product name: Recombinant human Histone H2B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-126 aa of BC005827 Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species |
| Full Name | histone cluster 2, H2be |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14-17 kDa |
| GenBank Accession Number | BC005827 |
| Gene Symbol | Histone H2B |
| Gene ID (NCBI) | 8349 |
| RRID | AB_10664929 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histone H2B is a core component of the nucleosome, the fundamental unit of chromatin. It forms a dimer with Histone H2A, and two H2A-H2B dimers combine with a (H3-H4)₂ tetramer to create the histone octamer. The primary function of this structure is to package DNA into a compact and manageable form. However, H2B is also subject to various post-translational modifications (PTMs), such as ubiquitination, which serve as epigenetic marks to regulate gene expression by altering chromatin accessibility.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Histone H2B antibody 15857-1-AP | Download protocol |
| IP protocol for Histone H2B antibody 15857-1-AP | Download protocol |
| WB protocol for Histone H2B antibody 15857-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Histone H2B Polyclonal antibody (Cat# 15857-1-AP) has 33 citations spanning 25 journals, including Nature Nanotechnology, Nature Metabolism, Nature Biomedical Engineering, Nature Cell Biology, Nature Communications, Cell Stem Cell, Cell Reports, Science Advances, Cell Discovery, and eLife. Research fields covered include cancer biology, epigenetics and chromatin regulation, cell biology, neuroscience, bioengineering, proteomics, and stem cell biology. Applications cited include WB, IF, and IP.
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol Intercellular nanotubes mediate mitochondrial trafficking between cancer and immune cells. | ||
Nat Metab Cancer-associated fibroblasts require proline synthesis by PYCR1 for the deposition of pro-tumorigenic extracellular matrix. | ||
Nat Biomed Eng Aberrant chromatin reorganization in cells from diseased fibrous connective tissue in response to altered chemomechanical cues | ||
Cell Stem Cell A ketogenesis-ferroptosis axis maintains leukemic stem cell survival and leukemia progression. | ||
Nat Cell Biol Nuclear proteasomes buffer cytoplasmic proteins during autophagy compromise | ||
Nat Commun Polymer model integrates imaging and sequencing to reveal how nanoscale heterochromatin domains influence gene expression |
Reviews
What customers say
All three reviews rate the antibody 4 out of 5 stars for Western Blot applications. Users report strong, specific signal around 20–25 kDa in mouse cortex at 1:1000 dilution, with 1:2000 also working well. The antibody successfully detected H2B in Jurkat cells at 1:1000. One user tested it in HEK293 cells at 1:2000 without additional comments. Overall, reviewers find it reliable for detecting H2B across cell lines and tissue with consistent performance at dilutions between 1:1000 and 1:2000.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (11-19-2025) | Worked well to detect H2B in Jurkat cells at the right size.
|
Gunjita (Verified Customer) (01-06-2020) | N/A
|
Aurelie (Verified Customer) (11-19-2018) | strong signal around 20-25kda in mouse cortex (25µg) at 1:1000, (1:2000 should be ok as well)
|
