Tested Applications
| Positive WB detected in | MCF-7 cells, U-87 MG cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15656-1-AP targets Hexokinase 1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8008 Product name: Recombinant human HK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 583-917 aa of BC008730 Sequence: SDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS Predict reactive species |
| Full Name | hexokinase 1 |
| Calculated Molecular Weight | 102 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC008730 |
| Gene Symbol | Hexokinase 1 |
| Gene ID (NCBI) | 3098 |
| RRID | AB_2878162 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19367 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The hexokinases (HKs) catalyze the first obligatory step in glucose metabolism to generate glucose-6-phosphate. This not only furthers glucose entry by maintaining the concentration gradient for facilitated glucose influx but also provides the first intermediate for essentially all major pathways using glucose. There are four conventional HK isoforms, HK1/2/3/4, encoded by four different genes. Most adult tissues express only HK1. Muscle and adipose tissue use HK2 for glycolysis, liver, and pancreatic beta cells express HK4 (also called glucokinase) and do not express HK1 or HK2. (PMID: 31434645, PMID: 31848318)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Hexokinase 1 antibody 15656-1-AP | Download protocol |
| IHC protocol for Hexokinase 1 antibody 15656-1-AP | Download protocol |
| WB protocol for Hexokinase 1 antibody 15656-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Hexokinase 1 Polyclonal antibody (Cat# 15656-1-AP) has 15 citations published in journals including Cancer Discovery, Cell Death & Disease, Oncogene, Small, Journal of Nanobiotechnology, International Journal of Molecular Sciences, Journal of Lipid Research, Cell Signaling, Journal of Cellular and Molecular Medicine, Frontiers in Neuroscience, Radiation Oncology, Journal of Traditional Chinese Medicine, Medical Science Monitor, OncoTargets and Therapy, and Aging. Research fields span cancer biology, glycolysis/energy metabolism, inflammation, osteoarthritis, wound healing, sepsis, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Cancer Discov Proteogenomic Markers of Chemotherapy Resistance and Response in Triple-Negative Breast Cancer | ||
J Nanobiotechnology Lacc1-engineered extracellular vesicles reprogram mitochondrial metabolism to alleviate inflammation and cartilage degeneration in TMJ osteoarthritis | ||
Cell Death Dis The dual mechanism of m6A demethylase ALKBH5 in regulating energy metabolism during exposure to MC-LR | ||
Small A Constant Filgotinib Delivery Adhesive Platform Based on Polyethylene Glycol (PEG) Hydrogel for Accelerating Wound Healing via Restoring Macrophage Mitochondrial Homeostasis | ||
Oncogene HDAC6-G3BP2 promotes lysosomal-TSC2 and suppresses mTORC1 under ETV4 targeting-induced low-lactate stress in non-small cell lung cancer | ||
Int J Mol Sci Intermittent Hypoxia Promotes TAM-Induced Glycolysis in Laryngeal Cancer Cells via Regulation of HK1 Expression through Activation of ZBTB10 |
