• Featured Product
  • KD/KO Validated

Hexokinase 1 Polyclonal antibody

Hexokinase 1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 19662-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IF/ICC, IP, ELISA

HK1, Hexokinase-A, Hexokinase-1, Hexokinase1, Hexokinase type I

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, MCF-7 cells, HepG2 cells, mouse brain tissue, rat brain tissue, THP-1 cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse brain tissue, human stomach tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19662-1-AP targets Hexokinase 1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8015

Product name: Recombinant human HK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 583-917 aa of BC008730

Sequence: SDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS

Predict reactive species
Full Name hexokinase 1
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC008730
Gene Symbol Hexokinase 1
Gene ID (NCBI) 3098
RRIDAB_10859778
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19367
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The hexokinases (HKs) catalyze the first obligatory step in glucose metabolism to generate glucose-6-phosphate. This not only furthers glucose entry by maintaining the concentration gradient for facilitated glucose influx but also provides the first intermediate for essentially all major pathways using glucose. There are four conventional HK isoforms, HK1/2/3/4, encoded by four different genes. Most adult tissues express only HK1. Muscle and adipose tissue use HK2 for glycolysis, liver, and pancreatic beta cells express HK4 (also called glucokinase) and do not express HK1 or HK2. (PMID: 31434645, PMID: 31848318)

Protocols

Product Specific Protocols
WB protocol for Hexokinase 1 antibody 19662-1-APDownload protocol
IHC protocol for Hexokinase 1 antibody 19662-1-APDownload protocol
IF protocol for Hexokinase 1 antibody 19662-1-APDownload protocol
IP protocol for Hexokinase 1 antibody 19662-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Metab

Dual impacts of serine/glycine-free diet in enhancing antitumor immunity and promoting evasion via PD-L1 lactylation

Authors - Huan Tong
humanWB

Cell Stem Cell

Generation of human alveolar epithelial type I cells from pluripotent stem cells

Authors - Claire L Burgess
mouseWB

Nat Immunol

NF-κB-inducing kinase maintains T cell metabolic fitness in antitumor immunity.

Authors - Meidi Gu
human,mouseWB,IP,IF

Sci Adv

Oligodendroglial glycolytic stress triggers inflammasome activation and neuropathology in Alzheimer's disease.

Authors - Xinwen Zhang
humanWB

Nat Commun

SUMOylation controls the binding of hexokinase 2 to mitochondria and protects against prostate cancer tumorigenesis.

Authors - Xun Shangguan
pigWB

Br J Pharmacol

PMID: 30515768

Authors - Xiaoying Lian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Wei (Verified Customer) (01-30-2020)

Strong, clear band for mouse heart.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Mouse Heart
FH

SCOTT (Verified Customer) (11-20-2018)

Used 1 in/1000 in 5% BSA TBS-Tween overnight at 4 C rolling. The membrane was blocked in 5% BSA TBS-Tween prior to adding the antibody.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human induced neuronal progenitor derived astrocytes
Hexokinase 1 Antibody Western Blot, validation (1/1000 dilution) in Human induced neuronal progenitor derived astrocytes (Cat no:19662-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...