HKDC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HKDC1 Polyclonal antibody (25874-1-AP)

• 

  WB analysis using 25874-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25874-1-AP (HKDC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 25874-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25874-1-AP (HKDC1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 25874-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25874-1-AP (HKDC1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse skeletal muscle using 25874-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25874-1-AP (HKDC1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 25874-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25874-1-AP (HKDC1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

HKDC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25874-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

EC:2.7.1.1, hexokinase domain containing 1, Hexokinase domain-containing protein 1, Hexokinase HKDC1, Putative hexokinase HKDC1

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human skeletal muscle tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 11 publications below
• IHC: See 4 publications below
• IF: See 2 publications below

Product Information

25874-1-AP targets HKDC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23045

  Product name: Recombinant human HKDC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-210 aa of BC110504

  Sequence: MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAAVKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIRGNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDT

• Full Name: hexokinase domain containing 1
• Calculated Molecular Weight: 917 aa, 103 kDa
• Observed Molecular Weight: 102 kDa, 82-90 kDa
• GenBank Accession Number: BC110504
• Gene Symbol: HKDC1
• Gene ID (NCBI): 80201
• RRID: AB_2880279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2TB90
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cell Rep; Nuclear-localized HKDC1 promotes hepatocellular carcinoma through phosphorylating RBBP5 to upregulate H3K4me3; Authors - Ling Ye ; KD Validated
human	WB	Virol Sin; Establishment and characterization of a new cell culture system for hepatitis B virus replication and infection.; Authors - Yingying Song
human	WB	bioRxiv; p53-induced RNA-binding protein ZMAT3 inhibits transcription of a hexokinase to suppress mitochondrial respiration; Authors - Ravi Kumar ; KD Validated
human	WB,IHC	FASEB J; Mechano-induced arachidonic acid metabolism promotes keratinocyte proliferation through cPLA2 activity regulation; Authors - Shengzhou Shan
mouse,human	WB	Biochim Biophys Acta Mol Basis Dis; HKDC1 promotes the H3K18 lactylation of the promoter of ORMDL3 to induce the activation of hepatic stellate cells in liver cirrhosis.; Authors - Yanan Zhang
human	WB	J Cancer; HKDC1 enhances the proliferation, migration and glycolysis of pancreatic adenocarcinoma and is linked to immune infiltration; Authors - Qiang Pang