HLA-DMB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Daudi using 82922-1-RR (same clone as 82922-1-PBS)

  WB result of HLA-DMB antibody (82922-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HLA-DMB transfected Daudi cells. This data was developed using the same antibody clone with 82922-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 82922-1-RR (same clone as 82922-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82922-1-RR (HLA-DMB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82922-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 82922-1-RR (same clone as 82922-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82922-1-RR (HLA-DMB antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82922-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 82922-1-RR (same clone as 82922-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82922-1-RR (HLA-DMB antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82922-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Raji using 82922-1-RR (same clone as 82922-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using HLA-DMB antibody (82922-1-RR, Clone: 230123A3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 82922-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82922-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82922-1-RR against Human HLA-DMB were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

HLA-DMB Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 82922-1-PBS

Clone No.230123A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RING7, MHC class II antigen DMB, HLA DMB, DMB, 230123A3

---

Product Information

82922-1-PBS targets HLA-DMB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16320

  Product name: Recombinant human HLA-DMB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-263 aa of BC027175

  Sequence: MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS

• Full Name: major histocompatibility complex, class II, DM beta
• Calculated Molecular Weight: 263 aa, 29 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC027175
• Gene Symbol: HLA-DMB
• Gene ID (NCBI): 3109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28068
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are composed of two non-covalently associated alpha and beta chains. HLA-DMA and HLA-DMB form a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA-DM plays a critical role in catalyzing the release of Class II HLA-associated invariant chain-derived peptides (CLIP) from newly synthesized class II HLA molecules and freeing the peptide binding site for acquisition of antigenic peptides.