HLA-DQB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HLA-DQB1 Polyclonal antibody, PBS Only (32281-1-PBS)

• 

  WB analysis using 32281-1-AP (same clone as 32281-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32281-1-AP (HLA-DQB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 32281-1-AP (same clone as 32281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 32281-1-AP (HLA-DQB1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32281-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 32281-1-AP (same clone as 32281-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 32281-1-AP (HLA-DQB1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32281-1-PBS in a different storage buffer formulation.

HLA-DQB1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32281-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

HLA class II histocompatibility antigen, DQ beta 1 chain, HLA-DQB, MHC class II antigen DQB1

---

Product Information

32281-1-PBS targets HLA-DQB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34755

  Product name: Recombinant human HLA-DQB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-230 aa of BC012106

  Sequence: RDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQSESAQSK

• Full Name: major histocompatibility complex, class II, DQ beta 1
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012106
• Gene Symbol: HLA-DQB1
• Gene ID (NCBI): 3119
• RRID: AB_3742566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P01920
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The HLA-DQB1 gene is part of the human leukocyte antigen (HLA) complex, which is involved in the immune system's ability to distinguish the body's own proteins from those made by foreign invaders such as viruses and bacteria. It belongs to the MHC class II genes, which provide instructions for making proteins present on the surface of certain immune system cells. These proteins attach to protein fragments (peptides) outside the cell and display them to the immune system. If the immune system recognizes the peptides as foreign, it triggers a response to attack the invading pathogens. .