HLA-DQB2 Polyclonal antibody

• 

  WB analysis of Raji using 17315-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 17315-1-AP (HLA-DQB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 17315-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17315-1-AP (HLA-DQB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 17315-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 17315-1-AP (HLA-DQB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

HLA-DQB2 Polyclonal Antibody for WB, ELISA

Cat No. 17315-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

HLA DQB1, HLA DQB2, HLA DXB, HLA-DQB2

---

Tested Applications

• Positive WB detected in: Raji cells, HepG2 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17315-1-AP targets HLA-DQB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11284

  Product name: Recombinant human HLA-DQB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-231 aa of BC031995

  Sequence: MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH

• Full Name: major histocompatibility complex, class II, DQ beta 2
• Calculated Molecular Weight: 231aa,27 kDa; 275aa,31 kDa
• Observed Molecular Weight: 27 kDa, 31 kDa
• GenBank Accession Number: BC031995
• Gene Symbol: HLA-DQB2
• Gene ID (NCBI): 3120
• RRID: AB_1939611
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05538
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.