HLCS Polyclonal antibody

• 

  WB analysis of HEK-293 using 14046-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14046-1-AP (HLCS antibody) at dilution of 1:700 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 14046-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14046-1-AP (HLCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14046-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14046-1-AP (HLCS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 14046-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 14046-1-AP (HLCS antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 14046-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 14046-1-AP (HLCS antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 14046-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using HLCS antibody (14046-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

HLCS Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14046-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Biotin protein ligase, Biotin apo-protein ligase, Biotin--[acetyl-CoA-carboxylase] ligase, Biotin--[methylcrotonoyl-CoA-carboxylase] ligase, Biotin--[methylmalonyl-CoA-carboxytransferase] ligase

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human kidney tissue, human liver tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14046-1-AP targets HLCS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5208

  Product name: Recombinant human HLCS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 425-726 aa of BC060787

  Sequence: SYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVILFAEVTPTTMRLLDGLMFQTPQEMGLIVIAARQTEGKGRGGNVWLSPVGCALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKQHKAELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKRR

• Full Name: holocarboxylase synthetase (biotin-(proprionyl-Coenzyme A-carboxylase (ATP-hydrolysing)) ligase)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC060787
• Gene Symbol: HLCS
• Gene ID (NCBI): 3141
• RRID: AB_2117166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50747
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.