HLF Polyclonal antibody

• 

  WB analysis of mouse liver using 12870-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12870-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12870-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12870-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 12870-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12870-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12870-1-AP (HLF antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat liver using 12870-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 12870-1-AP (HLF antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 12870-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 12870-1-AP (HLF antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 12870-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 12870-1-AP (HLF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 12870-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 12870-1-AP (HLF antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

HLF Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12870-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

hepatic leukemia factor

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, HEK-293 cells, K-562 cells, HepG2 cells, mouse liver tissue, mouse brain tissue
• Positive IHC detected in: rat liver tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

12870-1-AP targets HLF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3533

  Product name: Recombinant human HLF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC036093

  Sequence: MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL

• Full Name: hepatic leukemia factor
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 33kDa, 66 kDa
• GenBank Accession Number: BC036093
• Gene Symbol: HLF
• Gene ID (NCBI): 3131
• RRID: AB_11182935
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16534
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hepatic leukemia factor (Hlf), is a novel hepatic protein of the proline and acidic amino acid-rich basic leucine zipper (bZip) family, previously studied for its role in circadian rhythm regulated neurotransmitter metabolism in the brain (PMID: 29166614). HLF is an essential regulator of HSC quiescence and that HLF deficiency leads to an exhaustion of HSCs in adult mouse BM during regeneration or following cytotoxic stress (PMID: 29262330).Hlf is able to bind DNA specifically as a homodimer or as a heterodimer with other PAR factors (PMID: 1516826). Western blot analysis detected bands  33 kDa whereas the 66 kDa could be the dimer form of Hlf.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Front Immunol; Construction of an anaplastic thyroid cancer stratification signature to guide immune therapy selection and validation of the pivotal gene HLF through in vitro experiments; Authors - Li Pengping