HMCN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HMCN2 Polyclonal antibody (32178-1-AP)

• 

  WB analysis using 32178-1-AP

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 32178-1-AP (HMCN2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 32178-1-AP

  IP result of anti-HMCN2 (IP:32178-1-AP, 4ug; Detection:32178-1-AP 1:600) with SH-SY5Y cells lysate 1720 ug.

HMCN2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 32178-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

Hemicentin 2 , Hemicentin-2

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IP detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32178-1-AP targets HMCN2 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37696

  Product name: Recombinant human HMCN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-536 aa of XM_011518465.3

  Sequence: TLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSWEILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLS

• Full Name: hemicentin 2
• Calculated Molecular Weight: 542kDa，5059aa
• Observed Molecular Weight: 550 kDa
• GenBank Accession Number: XM_011518465.3
• Gene Symbol: HMCN2
• Gene ID (NCBI): 256158
• RRID: AB_3742536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NDA2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HMCN2 (Hemicentin-2) is a large extracellular matrix protein belonging to the fibronectin family. HMCN2 proteins form a complex network of microfibrils in the extracellular matrix that is essential for the maintenance of tissue structure and function. HMCN2 is expressed in epithelial cells and muscle tissues, and may play an important role in muscle-tendon attachment. HMCN2 expression and localization suggests that it has an important role in maintaining the integrity of skin and muscle tissue. It may maintain tissue structure and function by interacting with other extracellular matrix proteins, such as fibronectin and elastic fibers.