• Featured Product
  • KD/KO Validated

HMGB1 Recombinant monoclonal antibody, PBS Only

HMGB1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 82973-1-PBS
Clone No.230182G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

230182G6, high mobility group box 1, High mobility group protein 1, High mobility group protein B1, HMG 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82973-1-PBS targets HMGB1 in WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1264

Product name: Recombinant human HMGB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-215 aa of BC003378

Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Predict reactive species
Full Name high-mobility group box 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight25-30 kDa
GenBank Accession NumberBC003378
Gene Symbol HMGB1
Gene ID (NCBI) 3146
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09429
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The HMG (high mobility group) proteins are nonhistone chromosomal proteins that is present in almost all eukaryotic cells, and it functions to stabilize NUCLEOSOME formation and acts as a transcription-factor-like protein that regulates the expression of several genes[PMID: 18160415]. Once injury, infection or other inflammatory stimuli, activated macrophages, mature dendritic cells and natural killer cells can secret HMGB1, which act as a crucial cytokine[PMID: 20163887]. HMGB1 also involved in V(D)J recombination by acting as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS)[PMID: 19360789 ]. Act as a Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. HMGB1 (high mobility group box 1) modulates gene expression in the nucleus, but certain immune cells secrete HMGB1 as an extracellular Alarmin to signal tissue damage.The nuclear HMGB1 relocalizes to the extracellular milieu in senescent human and mouse cells in culture and in vivo, which stimulated cytokine secretion through TLR-4 signaling (23649808).

Loading...
||
New chat Able
正在加载,请稍候...