HMGB1 Fusion Protein

Source

E. coli-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

1

Cat no : Ag1264

Synonyms

DKFZp686A04236; HMG1; HMG3; SBP-1



Product Information

Peptide Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
(1-215 aa encoded by BC003378)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.

Publications

SpeciesTitle

Scand J Urol

High-mobility group box 1 is involved in the development of benign prostatic hyperplasia with chronic prostatic inflammation.

Authors - Rui Xue