Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

HMGB2 Monoclonal antibody

HMGB2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68185-1-Ig
Clone No. 1A7F10
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

HMG2, HMG 2, High mobility group protein B2, High mobility group protein 2, high mobility group box 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for HMGB2 in ?

Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, MCF-7 cells, HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman lung cancer tissue, mouse brain tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68185-1-Ig targets HMGB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7989

Product name: Recombinant human HMGB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-195 aa of BC000903

Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Predict reactive species
Full Name high-mobility group box 2
Calculated Molecular Weight 24 kDa
Observed Molecular Weight24-28 kDa
GenBank Accession NumberBC000903
Gene Symbol HMGB2
Gene ID (NCBI) 3148
RRIDAB_2935276
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP26583
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

High mobility group protein B2 (HMGB2) belongs to a family of highly conserved proteins that contain HMG box domains (11246022,14871457). All three family members (HMGB1, HMGB2, and HMGB3) contain two HMG box domains and a C-terminal acidic domain. HMGB1 is a widely expressed and highly abundant protein (14871457). HMGB2 is widely expressed during embryonic development, but it is restricted to lymphoid organs and testis in adult animals (11262228). HMGB3 is only expressed during embryogenesis (9598312). While expression varies, the biochemical properties of the different family members may be indistinguishable. The HMG box domains facilitate the binding of HMGB proteins to the minor groove of DNA, which results in local bending of the DNA double helix . HMGB proteins are recruited by and help facilitate the assembly of site-specific DNA binding proteins to their cognate binding sites in chromatin. For example, HMGB1 and HMGB2 facilitate the binding of Hox proteins, Oct proteins, p53, Rel proteins, and steroid hormone receptor proteins to their target gene promoters (11246022,14871457). Furthermore, HMGB2 interacts with RAG1 to facilitate RAG complex binding to the recombinant signal sequence (RSS) and stimulate DNA-bending and subsequent VDJ cleavage at antigen receptor genes (19317908 ,10490593). In addition to their functions in the nucleus, HMGB proteins play a significant role in extracellular signaling associated with inflammation. HMGB2 is secreted by myeloid cells and promotes proliferation and migration of endothelial cells by binding to the receptor for advanced glycation endproducts (RAGE) (19811285 ). Research studies have shown that HMGB2 overexpression in hepatocellular carcinoma is associated with poor prognosis and shorter survival time (20851854).The calculated molecular weight of HMGB2 is 24 kDa, and the post-modifiction of HMGB2 is about 33-35 kDa. (18218727)

Protocols

Product Specific Protocols
IHC protocol for HMGB2 antibody 68185-1-IgDownload protocol
WB protocol for HMGB2 antibody 68185-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able™

正在加载,请稍候...