• Featured Product
  • KD/KO Validated

HMGB2 Recombinant monoclonal antibody, PBS Only

HMGB2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), ELISA
Cat No. 83482-5-PBS
Clone No.240453H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

240453H5, high mobility group box 2, High mobility group protein 2, High mobility group protein B2, HMG 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83482-5-PBS targets HMGB2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6135

Product name: Recombinant human HMGB2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 44-207 aa of BC001063

Sequence: KCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDED

Predict reactive species
Full Name high-mobility group box 2
Calculated Molecular Weight 24 kDa
GenBank Accession NumberBC001063
Gene Symbol HMGB2
Gene ID (NCBI) 3148
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP26583
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

High mobility group protein B2 (HMGB2) belongs to a family of highly conserved proteins that contain HMG box domains (11246022,14871457). All three family members (HMGB1, HMGB2, and HMGB3) contain two HMG box domains and a C-terminal acidic domain. HMGB1 is a widely expressed and highly abundant protein (14871457). HMGB2 is widely expressed during embryonic development, but it is restricted to lymphoid organs and testis in adult animals (11262228). HMGB3 is only expressed during embryogenesis (9598312). While expression varies, the biochemical properties of the different family members may be indistinguishable. The HMG box domains facilitate the binding of HMGB proteins to the minor groove of DNA, which results in local bending of the DNA double helix . HMGB proteins are recruited by and help facilitate the assembly of site-specific DNA binding proteins to their cognate binding sites in chromatin. For example, HMGB1 and HMGB2 facilitate the binding of Hox proteins, Oct proteins, p53, Rel proteins, and steroid hormone receptor proteins to their target gene promoters (11246022,14871457). Furthermore, HMGB2 interacts with RAG1 to facilitate RAG complex binding to the recombinant signal sequence (RSS) and stimulate DNA-bending and subsequent VDJ cleavage at antigen receptor genes (19317908 ,10490593). In addition to their functions in the nucleus, HMGB proteins play a significant role in extracellular signaling associated with inflammation. HMGB2 is secreted by myeloid cells and promotes proliferation and migration of endothelial cells by binding to the receptor for advanced glycation endproducts (RAGE) (19811285 ). Research studies have shown that HMGB2 overexpression in hepatocellular carcinoma is associated with poor prognosis and shorter survival time (20851854).The calculated molecular weight of HMGB2 is 24 kDa, and the post-modifiction of HMGB2 is about 33-35 kDa. (18218727)

Loading...
||
New chat Able
正在加载,请稍候...