Tested Applications
| Positive WB detected in | BGC-823 cells, MCF-7 cells, SGC-7901 cells, human placenta tissue |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27465-1-AP targets HMGB3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26361 Product name: Recombinant human HMGB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC070482 Sequence: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF Predict reactive species |
| Full Name | high-mobility group box 3 |
| Calculated Molecular Weight | 200 aa, 23 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC070482 |
| Gene Symbol | HMGB3 |
| Gene ID (NCBI) | 3149 |
| RRID | AB_2880878 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15347 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HMGB3, also named HMG2A and HMG4, belongs to the HMGB family. HMGB3 binds to nucleosomes in a sequence-independent manner and participates in DNA repair, replication, transcription, and recombination. HMGB3 is highly expressed in stem cells and cancer cells and is rarely transactivated in normal adult tissues, making it a promising therapeutic target. Overexpressed HMGB3 is closely related to tumor occurrence and reduced survival in cervical cancer, non-small-cell lung cancer, breast cancer, bladder cancer, hepatocellular carcnoma, colorectal cancer, gastric cancer, and leukemia (PMID: 35332131).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HMGB3 antibody 27465-1-AP | Download protocol |
| IHC protocol for HMGB3 antibody 27465-1-AP | Download protocol |
| WB protocol for HMGB3 antibody 27465-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
27465-1-AP is an anti-HMGB3 antibody with 11 total citations. Citations appear in journals including Cancer Communications, Journal of the American Chemical Society, Journal of Experimental & Clinical Cancer Research, Journal for ImmunoTherapy of Cancer, Cell Communication and Signaling, Frontiers in Cell and Developmental Biology, FASEB Journal, Frontiers in Oncology, Genes, International Journal of General Medicine, and Current Medical Science. Research fields span cancer biology (lung, cervical, ovarian, colorectal, gastric, and non-small cell lung cancers), DNA repair, radioresistance, macrophage polarization, and exosome-mediated signaling.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) HMGB3 promotes brain metastasis of lung adenocarcinoma by recruiting SSBP1 for nuclear translocation to remodel mitochondrial metabolism.
| ||
J Am Chem Soc HMGB3 and SUB1 Bind to and Facilitate the Repair of N2-Alkylguanine Lesions in DNA
| ||
J Immunother Cancer Tumor-derived HMGB2 induces M2-like macrophage polarization via TRIM65-mediated NLRP3 degradation to promote DLBCL progression. | ||
Cell Commun Signal HMGB3 promotes the malignant phenotypes and stemness of epithelial ovarian cancer through the MAPK/ERK signaling pathway
| ||
Front Cell Dev Biol HMGB3 is a Potential Therapeutic Target by Affecting the Migration and Proliferation of Colorectal Cancer.
|
Reviews
What customers say
One reviewer reported a poor experience with this antibody in Western Blot (lot 00053979). They observed many non-specific bands and two bands near the HMGB3 molecular weight, making it difficult to distinguish the target band, particularly in the wild-type group. Overall, the reviewer found the antibody performance unsatisfactory for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ting (Verified Customer) (10-18-2023) | The Antibody looked bad. I saw many non-specific bands and two bands near the HMGB3 molecular weight when I use this antibody. It is really hard to distinguish the bands, especially for Wild-type group.
 |
