HMGB4 Polyclonal antibody

• 

  WB analysis of mouse testis using 12787-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12787-1-AP (HMGB4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 12787-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 12787-1-AP (HMGB4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

HMGB4 Polyclonal Antibody for WB, ELISA

Cat No. 12787-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

high mobility group box 4, HMGB4

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12787-1-AP targets HMGB4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3503

  Product name: Recombinant human HMGB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC021180

  Sequence: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS

• Full Name: high-mobility group box 4
• Calculated Molecular Weight: 186 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC021180
• Gene Symbol: HMGB4
• Gene ID (NCBI): 127540
• RRID: AB_10638490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW32
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

High mobility group protein B4 (HMGB4) is a new member in the family of HMGB proteins. Unlike other HMGB-proteins, it is a mammalian specific protein that has two HMGB-boxes but lacks the acidic tail. HMGB4 is strongly and preferentially expressed in the adult mouse testis and weakly in the brain, but not in many other tissues (PMID: 18987332). It binds strongly to nuclear structures, regulates chromatin and mediates differentiation of neuronal cells (PMID: 27608812).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Nuclear exosome HMGB3 secreted by nasopharyngeal carcinoma cells promotes tumour metastasis by inducing angiogenesis.; Authors - Kaiwen Zhang