HMGN4 Polyclonal antibody

• 

  WB analysis of HeLa using 11686-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11686-1-AP (HMGN4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 11686-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HMGN4 antibody (11686-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

HMGN4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 11686-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Non-histone chromosomal protein HMG-17-like 3, Non-histone chromosomal protein, NHC, HMG17L3, High mobility group nucleosome-binding domain-containing protein 4

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11686-1-AP targets HMGN4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2298

  Product name: Recombinant human HMGN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC001282

  Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

• Full Name: high mobility group nucleosomal binding domain 4
• Calculated Molecular Weight: 90 aa, 10 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC001282
• Gene Symbol: HMGN4
• Gene ID (NCBI): 10473
• RRID: AB_2118489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00479
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HMGN4, also named as High mobility group nucleosome-binding domain-containing protein 4, is a 90 amino acid protein, which belongs to the HMGN family. HMGN4 as a DNA-binding protein localizes in the nucleus. The calculated molecular weight of HMGN4 is 10 kDa, but the modified HMGN4 protein is about 15 kDa.