HMX2 Polyclonal antibody

• 

  WB analysis using 23160-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23160-1-AP (HMX2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

HMX2 Polyclonal Antibody for WB, ELISA

Cat No. 23160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

H6 family homeobox 2, H6L, Homeobox protein HMX2, Nkx5 2

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23160-1-AP targets HMX2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19564

  Product name: Recombinant human HMX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC137139

  Sequence: MGSKEDAGKGCPAAGGVSSFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGWKAPACFCPDQHGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEKERLLPAGSPSPGSERPRDGGAERQAGAAKK

• Full Name: H6 family homeobox 2
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC137139
• Gene Symbol: HMX2
• Gene ID (NCBI): 3167
• RRID: AB_3669409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: A2RU54
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.