HMX3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HMX3 Polyclonal antibody (34183-1-AP)

• 

  WB analysis using 34183-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34183-1-AP (HMX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 34183-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34183-1-AP (HMX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 34183-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 34183-1-AP (HMX3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 34183-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HMX3 antibody (34183-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

HMX3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 34183-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Homeobox protein H6 family member 3, Homeobox protein HMX3, Homeobox protein Nkx-5.1, NKX-5.1, NKX5-1

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34183-1-AP targets HMX3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41398

  Product name: Recombinant human HMX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-169 aa of NM_001105574

  Sequence: GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPEPLLKADPDHKELDS

• Full Name: H6 family homeobox 3
• Calculated Molecular Weight: 357aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_001105574
• Gene Symbol: HMX3
• Gene ID (NCBI): 340784
• RRID: AB_3743167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NHT5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

H6 family homeobox 3 (HMX3) is also named Homeobox protein H6 family member 3 and NKX-5.1. HMX3 is identified as a protein-coding gene, and diseases associated with HMX3 primarily include upper semicircular canal dehiscence and semicircular canal dehiscence syndrome (PMID: 22779713). In addition, as a transcription factor, HMX3 is involved in the regulation of nerve cell types, which is essential for the development of the inner ear and hypothalamus (PMID: 27151948, PMID: 15363417). HMX3 is lowly expressed in CRC, and HMX3 expression was negatively correlated with poor prognosis of CRC patients (PMID: 36204976).