HNF1A Polyclonal antibody

• 

HNF1A Polyclonal Antibody for ELISA

Cat No. 18335-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

HNF 1 alpha, HNF 1A, HNF1, HNF1 homeobox A, HNF1A, LFB1, MODY3, TCF 1, TCF1, Transcription factor 1

---

Product Information

18335-1-AP targets HNF1A in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12988

  Product name: Recombinant human HNF1A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 111-429 aa of BC104910

  Sequence: DPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPASLGPTFTNT

• Full Name: HNF1 homeobox A
• Calculated Molecular Weight: 631 aa, 67 kDa
• GenBank Accession Number: BC104910
• Gene Symbol: HNF1A
• Gene ID (NCBI): 6927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20823
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.