HNMT Recombinant monoclonal antibody

• 

  WB analysis using 84777-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84777-3-RR (HNMT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 84777-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84777-3-RR against Human HNMT were performed. The affinity constant is below 1 pM.

HNMT Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84777-3-RR

Clone No.242159E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HNMT S1, HMT, Histamine N-methyltransferase, histamine N methyltransferase, EC:2.1.1.8

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84777-3-RR targets HNMT in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2462

  Product name: Recombinant human HNMT protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-292 aa of BC020677

  Sequence: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

• Full Name: histamine N-methyltransferase
• Calculated Molecular Weight: 292 aa, 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC020677
• Gene Symbol: HNMT
• Gene ID (NCBI): 3176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P50135
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNMT, a histamine-metabolizing enzyme, inactivates histamine by N-methylation. It plays an important role in degrading histamine and in regulating the airway response to histamine. HNMT in human astrocytes play a role in the regulation of extraneuronal histamine concentration and the activities of histaminergic neurons.