Filter: AllWBIHCIF/ICC

WB analysis using 67844-1-Ig (same clone as 67844-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 67844-1-Ig (same clone as 67844-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
WB analysis of RAW 264.7 using 67844-1-Ig (same clone as 67844-1-PBS)
RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67844-1-Ig (same clone as 67844-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67844-1-Ig (HNRNPA1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 67844-1-Ig (same clone as 67844-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPA1 antibody (67844-1-Ig, Clone: 1A5A4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red). This data was developed using the same antibody clone with 67844-1-PBS in a different storage buffer formulation.

HNRNPA1 Monoclonal antibody, PBS Only

HNRNPA1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67844-1-PBS

Clone No.1A5A4

Review Product

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

hnRNP core protein A1, hnRNP A1, Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed, Helix-destabilizing protein, Helix destabilizing protein

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67844-1-PBS targets HNRNPA1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag17415 Product name: Recombinant human HNRNPA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-320 aa of BC009600 Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Predict reactive species
Full Name	heterogeneous nuclear ribonucleoprotein A1
Calculated Molecular Weight	34 kDa
Observed Molecular Weight	34 kDa
GenBank Accession Number	BC009600
Gene Symbol	HNRNPA1
Gene ID (NCBI)	3178
RRID	AB_2918606
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P09651
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

In eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.