HNRNPC Monoclonal antibody, PBS Only

• 

  WB analysis using 68447-1-Ig (same clone as 68447-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68447-1-Ig (HNRNPC antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68447-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 68447-1-Ig (same clone as 68447-1-PBS)

  IP result of anti-HNRNPC (IP:68447-1-Ig, 4ug; Detection:68447-1-Ig 1:4000) with HeLa cells lysate 1560 ug. This data was developed using the same antibody clone with 68447-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68447-1-Ig (same clone as 68447-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPC antibody (68447-1-Ig, Clone: 2G8G4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68447-1-PBS in a different storage buffer formulation.

HNRNPC Monoclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 68447-1-PBS

Clone No.2G8G4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse , rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

C1, C2, HNRNP, hnRNP C1/C2, HNRNPC, HNRPC, SNRPC

---

Product Information

68447-1-PBS targets HNRNPC in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with Human, mouse , rat samples.

• Tested Reactivity: Human, mouse , rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2356

  Product name: Recombinant human HNRNPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC003394

  Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS

• Full Name: heterogeneous nuclear ribonucleoprotein C (C1/C2)
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC003394
• Gene Symbol: HNRNPC
• Gene ID (NCBI): 3183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P07910
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.