HNRNPK Monoclonal antibody, PBS Only

HNRNPK Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67708-1-PBS
Clone No.1A10C8

Host / Isotype

Mouse / IgM

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

CSBP, FLJ41122, hnRNP K, HNRNPK, HNRPK, TUNP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67708-1-PBS targets HNRNPK in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30093

Product name: Recombinant human HNRNPK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 114-463 aa of BC014980

Sequence: LPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

Predict reactive species
Full Name heterogeneous nuclear ribonucleoprotein K
Calculated Molecular Weight 463 aa, 51 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberBC014980
Gene Symbol HNRNPK
Gene ID (NCBI) 3190
RRIDAB_2882899
Conjugate Unconjugated
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP61978
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HNRNPK belongs to the heterogeneous nuclear ribonucleoprotein family of 20 proteins that participate in a wide range of key cellular functions involving many of the pathways implicated, disrupted or dysregulated in tumor development and progression. It is also a conserved pre-mRNA-binding protein that is involved in multiple processes of gene expression, including chromatin remodeling, transcription, and mRNA splicing, translation, and stability

Loading...
||
New chat Able
正在加载,请稍候...